Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2C4, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... YY1(7528)
General description
The gene YY1 (Yin Yang 1) encodes a protein belonging to the GLI-Krüppel gene family. It is a zinc finger protein that is ubiquitously expressed. The YY1 gene is mapped to human chromosome 14q32.
Immunogen
YY1 (NP_003394, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
Sequence
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
Application
Monoclonal Anti-YY1 antibody produced in mouse has been used in immunohistochemistry.
Biochem/physiol Actions
YY1 (Yin Yang 1) is a transcriptional repressor protein encoded by the YY1 gene in humans. It regulates diverse biological processes and may have an important role in carcinogenesis. Its expression is found to be upregulated in gastric cancer cell lines and primary gastric cancers. YY1 is found to contribute to carcinogenesis in gastric cancer. This DNA-binding protein is found to regulate the activity of the c-fos promoter. YY1 has roles in cell proliferation, differentiation, apoptosis and cell cycle progression.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
YY1 DNA binding and interaction with YAF2 is essential for Polycomb recruitment
Arindam Basu
Nucleic Acids Research, 42 (2013)
Transcription factor YY1 expression in human gastrointestinal cancer cells
Dharmaraj Chinnappan
International Journal of Oncology, 34 (2009)
DNA bending and orientation-dependent function of YY1 in the c-fos promoter
S Natesan
Genes & Development, 7 (1993)
Transcriptional repression by YY1, a human GLI-Kruppel-related protein, and relief of repression by adenovirus E1A protein
Y Shi
Cell, 34 (2009)
Expression of YY1 in Differentiated Thyroid Cancer
Jessica Arribas
Endocrine Pathology (2015)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service