WH0007976M9
Monoclonal Anti-FZD3 antibody produced in mouse
clone 2H5, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-Fz3, Anti-frizzled homolog 3 (Drosophila), Anti-hFz3
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2H5, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... FZD3(7976)
General description
Frizzled class receptor 3 (FZD3) is a receptor with seven-transmembrane domains and it is expressed in human melanocytes. The gene encoding it is localized on human chromosome 8p21.1.
Immunogen
FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
Sequence
QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
Biochem/physiol Actions
Frizzled class receptor 3 (FZD3) modulates the growth of longitudinal axon tracts in the central nervous system. It mediates the dynamics of axon within the enteric, sympathetic and peripheral nervous systems. FZD3 regulates planar cell polarity. Abnormal FZD3 gene methylation causes chromatin structure modifications, associated with congenital hydrocephalus. Mutation in FZD3 gene is associated with Hirschsprung disease, a birth defect lacking the intrinsic ganglion cells of the lower intestine.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The roles of Frizzled-3 and Wnt3a on melanocyte development: in vitro studies on neural crest cells and melanocyte precursor cell lines.
Chang CH
The Journal of Dermatology (2014)
Genotype-phenotype association studies of chromosome 8p inverted duplication deletion syndrome.
Fisch GS
Behavior Genetics (2011)
Impaired methylation modifications of FZD3 alter chromatin accessibility and are involved in congenital hydrocephalus pathogenesis.
Wang L
Brain Research (2014)
Celsr3 and Fzd3 in axon guidance.
The International Journal of Biochemistry & Cell Biology (2015)
Deregulation of the planar cell polarity genes CELSR3 and FZD3 in Hirschsprung disease.
Su L
Experimental and Molecular Pathology, 101(2), 241-248 (2016)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service