WH0009075M1
Monoclonal Anti-CLDN2 antibody produced in mouse
clone 3F1, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-claudin 2
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3F1, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CLDN2(9075)
General description
Claudin-2 (CLDN2) is one of the pore-forming claudins and is a member of the claudin family of proteins. It is present in the proximal tubules and the gene encoding it is localized on human chromosome Xq22.
Immunogen
CLDN2 (NP_065117, 29 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA
Sequence
SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA
Biochem/physiol Actions
Claudin-2 (CLDN2) controls paracellular permeability and maintains cell polarity in epithelial and endothelial cell sheets. In MDCK (madin-darby canine kidney cells), claudin-2 participates in the generation of aqueous pores with high conductance.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Conversion of Zonulae Occludentes from Tight to Leaky Strand Type by Introducing Claudin-2 into Madin-Darby Canine Kidney I Cells
Mikio Furuse
The Journal of Biological Chemistry (2001)
Inhibition of Autophagic Degradation Process Contributes to Claudin-2 Expression Increase and Epithelial Tight Junction Dysfunction in TNF-a Treated Cell Monolayers
Cong Zhang
International Journal of Molecular Sciences (2017)
Tumor necrosis factor-a induces a biphasic change in claudin-2 expression in tubular epithelial cells: role in barrier functions
Yasaman Amoozadeh
American Journal of Physiology. Cell Physiology (2015)
The claudins
Madhu Lal-Nag and Patrice J Morin
Genome Biology (2009)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service