biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
7B4, monoclonal
form
buffered aqueous solution
species reactivity
mouse, human, rat
technique(s)
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MAGI1(9223)
Immunogen
MAGI1 (NP_004733, 761 a.a. ~ 859 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
Sequence
SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
Application
Monoclonal Anti-MAGI1 antibody produced in mouse has been used for Western Blotting.
Biochem/physiol Actions
Membrane associated guanylate kinase, WW and PDZ domain containing 1 (MAGI1) acts as a scaffolding protein. It takes part in tight junction formation and binds to β-catenin to suppress the Wnt signaling pathway. The gene encoding it has been linked with schizophrenia and the protein is downregulated in hepatocellular carcinoma.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Regulation of interferon-? by MAGI-1 and its interaction with influenza A virus NS1 protein with ESEV PBM.
Kumar M, et.al
PLoS ONE, 7(7), e41251-e41251 (2012)
The E-cadherin/AmotL2 complex organizes actin filaments required for epithelial hexagonal packing and blastocyst hatching
Sebastian H
Scientific Reports (2017)
Downregulation of MAGI1 associates with poor prognosis of hepatocellular carcinoma.
Zhang G, et.al
Journal of Investigative Surgery, 25(2), 93-99 (2012)
21942217
Derringer J
JAMA Psychiatry (Chicago, Ill.), 72(7), 642-650 (2015)
AmotL2 integrates polarity and junctional cues to modulate cell shape
Sara Hultin
Scientific Reports, 7 (2017)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service