Monoclonal Anti-MERTK antibody produced in mouse

The gene MERTK (MER proto-oncogene, tyrosine kinase) is mapped to human chromosome 2q14.1. The encoded protein belongs to the Tyro3, Axl, and Mertk (TAM) family of receptor tyrosine kinases. MERTK is strongly expressed in macrophages, ovary, prostate, testis, lung and kidney. The protein has a conserved intracellular kinase domain and an extracellular adhesion molecule-like domain.

MERTK (NP_006334, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP

MERTK (MER proto-oncogene, tyrosine kinase) is mainly involved in the starting of efferocytosis, which is the removal of dying cells by phagocytosis. It interacts with two ligands, Gas6 (growth arrest-specific 6) and Protein-S. Mutation in this gene regulates the severity of fibrosis in patients with non-alcoholic fatty liver disease. Mutations in MERTK gene also result in autosomal recessive retinal degeneration due to faults in phagocytosis. MERTK is upregulated in malignant cells, including leukemia, lymphoma and colorectal cancer. Variants of this gene are detected in melanoma, multiple myeloma, renal cancer and carcinoma. MERTK is also overexpressed in sclerotic lesions.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.