Skip to Content
Merck
CN

WH0011213M1

Monoclonal Anti-IRAK3 antibody produced in mouse

clone 1A6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-IRAKM, Anti-interleukin-1 receptor-associated kinase 3

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Conjugate:
unconjugated
Clone:
1A6, monoclonal
Application:
indirect ELISA
western blot
Species reactivity:
human
Citations:
5
Technique(s):
indirect ELISA: suitable
western blot: 1-5 μg/mL
Uniprot accession no.:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Monoclonal Anti-IRAK3 antibody produced in mouse, clone 1A6, purified immunoglobulin, buffered aqueous solution

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1A6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... IRAK3(11213)

Biochem/physiol Actions

Interleukin 1 receptor associated kinase 3 (IRAK3) acts as an anti-inflammatory molecule and blocks IRAK-4,-1 signaling. It is also negatively regulated toll-like receptor/interleukin (IL)-1 receptor (Toll/IL-R) immune signal transduction. IRAK3 may be involved in the pathophysiology of the hepatocellular carcinoma.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Interleukin 1 receptor associated kinase 3 (IRAK3) belongs to the interleukin receptor associated kinase (IRAK) family that is capable of shuttling in and out of the nucleus. It is associated with monocytes and contains a kinase (homology) domain, signature death domain of the IRAK family, and a C-terminal domain. The IRAK3 gene is mapped to human chromosome 12q14.3.

Immunogen

IRAK3 (AAH57800, 497 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Chih-Chi Kuo et al.
World journal of gastroenterology, 21(13), 3960-3969 (2015-04-09)
To examine the methylation levels of interleukin-1 receptor-associated kinase 3 (IRAK3) and GLOXD1 and their potential clinical applications in hepatocellular carcinoma (HCC). mRNA expression and promoter methylation of IRAK3 and GLOXD1 in HCC cells were analyzed by reverse transcription-polymerase chain
Sofia Dória et al.
BMC medical genomics, 13(1), 2-2 (2020-01-05)
12q14 microdeletion syndrome is characterized by low birth weight and failure to thrive, proportionate short stature and developmental delay. The opposite syndrome (microduplication) has not yet been characterized. Our main objective is the recognition of a new clinical entity -
Morris Nechama et al.
Nature communications, 9(1), 1603-1603 (2018-04-25)
Interleukin 33 (IL-33) is among the earliest-released cytokines in response to allergens that orchestrate type 2 immunity. The prolyl cis-trans isomerase PIN1 is known to induce cytokines for eosinophil survival and activation by stabilizing cytokines mRNAs, but the function of
Degui Geng et al.
Communications biology, 3(1), 306-306 (2020-06-14)
Melanoma represents the most serious type of skin cancer. Although recent years have seen advances using targeted and immunotherapies, most patients remain at high risk for tumor recurrence. Here we show that IRAK-M, a negative regulator of MyD88 signaling, is
Lenuta Balaci et al.
American journal of human genetics, 80(6), 1103-1114 (2007-05-16)
Asthma is a multifactorial disease influenced by genetic and environmental factors. In the past decade, several loci and >100 genes have been found to be associated with the disease in at least one population. Among these loci, region 12q13-24 has

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service