WH0051232M1
Monoclonal Anti-CRIM1 antibody produced in mouse
clone 6E4, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-S52, Anti-cysteine-rich motor neuron 1
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
6E4, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CRIM1(51232)
General description
The gene encoding cysteine-rich motor neuron 1 (CRIM1) is localized on human chromosome 2p21. It is a putative transmembrane protein which possesses an insulin-like growth factor (IGF)-binding protein motif and multiple cysteine-rich repeats. CRIM1 is an antagonist of bone morphogenetic proteins. The CRIM1 gene encodes a type I transmembrane protein that is mainly expressed in angiogenic endothelial cells.
Immunogen
CRIM1 (NP_057525, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
Sequence
VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
Application
Monoclonal Anti-CRIM1 antibody produced in mouse has been used in Western blotting.
Biochem/physiol Actions
Cysteine-rich motor neuron 1 (CRIM1) may interact with growth factors implicated in motor neuron differentiation and survival. It may have a role in the development of the central nervous system (CNS). CRIM1 influences the adhesion and migration of cancer cells. It modulates the maturation of bone morphogenetic preprotein.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
nwg
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
CRIM1, a newfound cancer-related player, regulates the adhesion and migration of lung cancer cells.
Zeng H
Growth Factors (2015)
Crim1 maintains retinal vascular stability during development by regulating endothelial cell Vegfa autocrine signaling
Jieqing Fan
Development (2014)
CRIM1, a novel gene encoding a cysteine-rich repeat protein, is developmentally regulated and implicated in vertebrate CNS development and organogenesis.
Kolle G
Mechanisms of Development (2000)
Jieqing Fan et al.
Development (Cambridge, England), 141(2), 448-459 (2013-12-20)
Angiogenesis defines the process in which new vessels grow from existing vessels. Using the mouse retina as a model system, we show that cysteine-rich motor neuron 1 (Crim1), a type I transmembrane protein, is highly expressed in angiogenic endothelial cells.
CRIM1, the antagonist of BMPs, is a potential risk factor of cancer.
Zeng H and Tang L
Current Cancer Drug Targets (2014)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service