Merck
CN
All Photos(2)

Documents

Safety Information

WH0057804M1

Sigma-Aldrich

Monoclonal Anti-POLD4 antibody produced in mouse

clone 2B11, ascites fluid

Sign Into View Organizational & Contract Pricing
All Photos(2)
Synonym(s):
Anti-POLDS, Anti-p12, Anti-polymerase (DNA-directed), delta 4
NACRES:
NA.41

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

ascites fluid

antibody product type

primary antibodies

clone

2B11, monoclonal

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1:500-1:1000

isotype

IgG2bκ

GenBank® accession no.

BC001334

UniProt accession no.

Q9HCU8

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... POLD4(57804)

General description

DNA polymerase δ 4 (POLD4), also known as p12, is the smallest subunit of DNA polymerase (Pol) δ. It is encoded by the gene mapped to human chromosome 11q13.2.
The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).

Immunogen

POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

Biochem/physiol Actions

DNA polymerase (Pol) δ plays a vital role in DNA replication, DNA repair processes and genetic recombination. POLD4 stabilizes the Pol δ holoenzyme. In addition, it also facilitates pol δ-PCNA complex stabilization. Proteolysis of POLD4 in response to DNA damage leads to the consequent conversion of the holoenzyme pol δ4 to the heterotrimer pol δ3. Pol δ3 acts as an antimutator polymerase and is supposed to enhance surveillance against mutagenesis. Downregulated expression of the gene is associated with the genomic instability in lung cancer.

Physical form

Solution

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

PPP6R3?USP6 amplification: Novel oncogenic mechanism in malignant nodular fasciitis
Guo R, et al.
Genes Chromosomes Cancer, 640-9 null
A novel DNA damage response: rapid degradation of the p12 subunit of dna polymerase delta.
Zhang S, et al.
The Journal of Biological Chemistry, 15330-40 null
Proteolysis of the Human DNA Polymerase Delta Smallest Subunit p12 by μ-Calpain in Calcium-Triggered Apoptotic HeLa Cells
Fan X, et al.
PLoS ONE null
Regulation of DNA Polymerase POLD4 Influences Genomic Instability in Lung Cancer
Huang QM, et al.
Cancer Research, 8407-16 null
Prashant Khandagale et al.
Life science alliance, 2(2) (2019-03-20)
Human DNA polymerase delta (Polδ), a holoenzyme consisting of p125, p50, p68, and p12 subunits, plays an essential role in DNA replication, repair, and recombination. Herein, using multiple physicochemical and cellular approaches, we found that the p12 protein forms a

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service