Skip to Content
Merck
CN

WH0084444M1

Sigma-Aldrich

Monoclonal Anti-DOT1L antibody produced in mouse

clone 6A6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DOT1, Anti-DOT1-like, histone H3 methyltransferase (S. cerevisiae), Anti-KIAA1814

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6A6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DOT1L(84444)

General description

Disruptor of telomeric silencing 1 (DOT1) like histone lysine methyltransferase (DOT1L) is encoded by the gene mapped to human chromosome 19p13.3.

Immunogen

DOT1L (NP_115871, 3 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR

Biochem/physiol Actions

Disruptor of telomeric silencing 1 (DOT1) like histone lysine methyltransferase (DOT1L), is a nucleosomal enzyme that catalyzes the intra-nucleosomal methylation of H3 at lysine-79, a crucial step involved in the regulation of cell cycle, transcriptional regulation, and DNA damage response. Mammalian DOT1 gene plays an essential role in embryogenesis, hematopoiesis, cardiac function, and development of leukemia. Thus, DOT1L can act as a potential target for therapeutic treatment of the same. Elevated DOT1L enzymatic activity leads to MLL (mixed-lineage leukemia). Therefore, inhibition of DOT1L by SYC-522 in combination with DNA-damaging chemotherapy is considered as a potential treatment for MLL.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Wei Liu et al.
PloS one, 9(5), e98270-e98270 (2014-05-27)
DOT1L, the only known histone H3-lysine 79 (H3K79) methyltransferase, has been shown to be essential for the survival and proliferation of mixed-linkage leukemia (MLL) gene rearranged leukemia cells, which are often resistant to conventional chemotherapeutic agents. To study the functions
Anh Tram Nguyen et al.
Genes & development, 25(13), 1345-1358 (2011-07-05)
DOT1 (disruptor of telomeric silencing; also called Kmt4) was initially discovered in budding yeast in a genetic screen for genes whose deletion confers defects in telomeric silencing. Since the discovery ∼10 years ago that Dot1 and its mammalian homolog, DOT1L
Megumi Hirokawa et al.
European journal of human genetics : EJHG, 23(3), 374-380 (2014-06-12)
Despite considerable progress in preventive and therapeutic strategies, myocardial infarction (MI) is one of the leading causes of death throughout the world. A total of 55 susceptibility genes have been identified mostly in European genome-wide association studies (GWAS). Nevertheless, large-scale

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service