Skip to Content
Merck
CN

WH0152503M1

Sigma-Aldrich

Monoclonal Anti-SH3D19 antibody produced in mouse

clone 5C7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-EVE1, Anti-MGC105136, Anti-MGC118910, Anti-SH3 domain protein D19

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5C7, monoclonal

form

buffered aqueous solution

species reactivity

human, mouse, rat

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG3κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SH3D19(152503)

General description

SH3 domain containing 19 (SH3D19) is a cytoplasmic protein and the gene encoding it is localized on human chromosome 4q31.3.

Immunogen

SH3D19 (NP_001009555, 94 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAPRPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLI

Biochem/physiol Actions

SH3 domain containing 19 (SH3D19) inhibits processes induced by Ras oncoprotein. It binds to a protein called EEN (extra eleven-nineteen leukemia fusion gene protein), part of the endophilin family, and modulates the activity of ADAMs (a disintegrin and metalloproteases).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Motonari Tanaka et al.
The Journal of biological chemistry, 279(40), 41950-41959 (2004-07-29)
A disintegrin and metalloproteases (ADAMs) are implicated in the ectodomain shedding of epidermal growth factor receptor (EGFR) ligands in EGFR transactivation. However, the activation mechanisms of ADAMs remain elusive. To analyze the regulatory mechanisms of ADAM activation, we performed yeast
Judy Wai Ping Yam et al.
Blood, 103(4), 1445-1453 (2003-10-11)
The chimeric MLL-EEN fusion protein is created as a result of chromosomal translocation t(11;19)(q23;p13). EEN, an Src homology 3 (SH3) domain-containing protein in the endophilin family, has been implicated in endocytosis, although little is known about its role in leukemogenesis
TuDung T Nguyen et al.
Genes, chromosomes & cancer, 45(10), 918-932 (2006-07-22)
Three patients diagnosed with acute myeloid leukemia (AML) with reciprocal 21q22/RUNX1(AML1) translocations involving chromosomes 1 and 4 were studied. Three novel RUNX1 translocation partner genes on 1q21.2 (ZNF687), 1p35 (YTHDF2), and 4q31.3 (SH3D19) were identified using a panhandle polymerase chain

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service