Skip to Content
Merck
CN

WH0246243M1

Monoclonal Anti-RNASEH1 antibody produced in mouse

clone 5D10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-H1RNA, Anti-ribonuclease H1

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5D10, monoclonal

form

buffered aqueous solution

species reactivity

human, rat, mouse

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RNASEH1(246243)

General description

Ribonuclease H1 (RNASEH1) is an endonuclease which is expressed in the mitochondria and nucleus. It possesses two domains which aid in binding to nucleic acids. The gene encoding this protein is localized on human chromosome 2p25.

Immunogen

RNASEH1 (NP_002927, 189 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED

Biochem/physiol Actions

Ribonuclease H1 (RNASEH1) digests the RNA segment in a DNA-RNA hybrid. Mutations in the gene encoding it have been associated with chronic progressive external ophthalmoplegia.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Aurelio Reyes et al.
American journal of human genetics, 97(1), 186-193 (2015-06-23)
Chronic progressive external ophthalmoplegia (CPEO) is common in mitochondrial disorders and is frequently associated with multiple mtDNA deletions. The onset is typically in adulthood, and affected subjects can also present with general muscle weakness. The underlying genetic defects comprise autosomal-dominant
E J Devor et al.
The Journal of heredity, 95(3), 257-261 (2004-06-29)
A retroprocessed pseudogene (retropseudogene) descended from the gene encoding ribonuclease (RNase) H1 has been found in ape genomes that preserves a splice junction mutation event that altered the carboxyl-terminal end of the enzyme. The GT --> GC transition mutant at
Christopher N Johnson et al.
Biochemistry, 50(19), 3903-3912 (2011-03-30)
Numerous DNA chemistries for improving oligodeoxynucleotide (ODN)-based RNA targeting have been explored. The majority of the modifications render the ODN/RNA target insensitive to RNase H1. Borano phosphonate ODN's are among the few modifications that are tolerated by RNase H1. To
So Hae Park et al.
Nucleic acids research, 49(13), 7507-7524 (2021-06-29)
Impaired replication progression leads to de novo copy number variant (CNV) formation at common fragile sites (CFSs). We previously showed that these hotspots for genome instability reside in late-replicating domains associated with large transcribed genes and provided indirect evidence that

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service