Anti-VDAC2 antibody produced in rabbit

VDAC2 is a voltage-dependant anion channel that forms a pathway for metabolite diffusion across the outer membrane of mitochondria. Studies have reported that VDAC2 interacts with BAK and subsequently regulates mitochondrial apoptosis/cell death.
Rabbit Anti-VDAC2 antibody recognizes chicken, human, mouse, rat, bovine, pig, canine, rabbit, and zebrafish VDAC2.

Synthetic peptide directed towards the N terminal region of human VDAC2

Rabbit Anti-VDAC2 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.