Anti-ZNF655 antibody produced in rabbit

ZNF655 codes for a nuclear zinc finger protein that negatively modulates G1/S transition during mitosis.
Rabbit Anti-ZNF655 antibody recognizes bovine, rat, canine, and human ZNF655.

Synthetic peptide directed towards the N terminal region of human ZNF655

Rabbit Anti-ZNF655 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

ZNF655 is a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions.This gene encodes a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGAPPVP

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.