biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
42 kDa
species reactivity
horse, human, mouse, guinea pig, dog, rabbit, rat, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PEX3(8504)
General description
Peroxisomal biogenesis factor 3 (PEX3, TRG18), a PEX19 docking protin, and PEX19 have key roles in the biogenesis of peroxisomes. Membrane-anchored PEX3 functions as a PEX19 receptor, wherein PEX19 recognizes newly synthesized peroxisomal membrane proteins (PMP) and recruits them to the peroxisomal membrane.
Immunogen
Synthetic peptide directed towards the N terminal region of human PEX3
Application
Anti-PEX3 polyclonal antibody is used to tag peroxisomal biogenesis factor 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of peroxisomal biogenesis factor 3 in peroxisome biosynthesis.
Biochem/physiol Actions
Anti-PEX3 polyclonal antibody reacts with bovine, human, mouse, rat, canine, zebrafish, and chicken peroxisomal biogenesis factor 3 proteins.
PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
存储类别
10 - Combustible liquids
怎么回事?
WGK 3
闪点 (F)
Not applicable
闪点 (°C)
Not applicable