Growth arrest and DNA-damage-inducible, β (GADD45B) regulates DNA demethylation, adult neurogenesis, p38 signaling and cellular apoptosis. Genetic defects or lack of GADD45B are known to affect long-term memory and synaptic plasticity.
Rabbit Anti-GADD45B antibody recognizes bovine, human, mouse, rat, and canine GADD45B.

The immunogen for anti-GADD45B antibody: synthetic peptide derected towards the middle region of human GADD45B

Rabbit Anti-GADD45B antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

Lyophilized from PBS buffer with 2% sucrose

Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.