biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
39 kDa
species reactivity
yeast, guinea pig, horse, rat, rabbit, human, dog, mouse, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LIAS(11019)
General description
Lipoic acid synthetase (LIAS) a mitochondrial protein that catalyzes the synthesis of α-(+)-lipoic acid synthesis. Deficiency of LIAS is linked to glycine elevation, defects in mitochondrial energy metabolism and neonatal-onset epilepsy.
Rabbit Anti-LIAS antibody recognizes human, mouse, and rat LIAS antibody.
Rabbit Anti-LIAS antibody recognizes human, mouse, and rat LIAS antibody.
Immunogen
Synthetic peptide directed towards the C terminal region of human LIAS
Application
Rabbit Anti-LIAS antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.
Biochem/physiol Actions
LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.The protein encoded by this gene belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
存储类别
10 - Combustible liquids
怎么回事?
WGK 3
闪点 (F)
Not applicable
闪点 (°C)
Not applicable