biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
98 kDa
species reactivity
horse, human, rabbit, bovine, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NUP98(4928)
General description
Nuclear pore complex protein is a protein encoded by the nucleoporin 98 kDa (NUP98) gene in humans. NUP98 gene encodes a peripheral membrane protein nucleoporin that belongs to nucleoporin GLFG family. This protein is formed from a precursor protein of 186 kDa that after cleavage yields two nucleoporins, Nup96 and Nup98. The nuclear import and export takes place through the nuclear pore complex (NPC), which is composed of unique proteins known as nucleoporins. The NUP98 gene of 122kb long, has 33 exons and is located on human chromosome 11p15.4.
Immunogen
Synthetic peptide directed towards the N terminal region of human NUP98
Application
Anti-NUP98 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
Nucleoporin 98 kDa (NUP98) functions as a docking protein for cytosol mediated docking of import substrates. During mitosis, NUP98 interacts with nucleocytoplasmic transport factors Rae1 and regulates the destruction of the securin protein by the anaphase-promoting complex (APC). Thus, Nucleoporins play an important function in nucleocytoplasmic transport, transcription and mitosis. Nuclear pore complex (NPC) also plays a role during nuclear processes such as chromatin silencing, transcriptional regulation and DNA damage repair. NUP98-Rae1 complex prevents aneuploidy. Overexpression of NUP98 along with other proteins and several associated nuclear export factors dysregulate signaling pathways and transcription resulting in alteration of nucleoporin functionality, which may cause cancer. NUP98 acts as an important predictor of anthracycline-based chemotherapy response in triple-negative breast cancer patients.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
存储类别
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable