抗-PSMC4 兔抗

The 26S proteasome is an ATP-dependent protease, which is a large complex of multiple subunits. It contains one catalytic subunit, 20S and two regulatory subunits called PA700. In humans, the PA700 contains six members, incluing PSMC4 (proteasome 26S subunit, ATPase, 4). It is also called TBP7 and the corresponding gene is located on chromosome 19q13.11-q13.13. PSMC4 is an ATPase and was initially identified as synphilin-1-interacting protein. Its molecular weight is around 50kDa.

26S protease regulatory subunit 6B recombinant protein epitope signature tag (PrEST)

Sequence
LTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLEL

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Proteasome 26S subunit, ATPase, 4 (PSMC4) regulates the assembly of the 26S proteasome complex. The HbYX motif present at the C-terminal of PSMC4 is essential for the assembly of 26S complex from PA700 and 20S subunits. Interaction of PSMC4 and TRAP1 (Tumor necrosis factor receptor-associated protein-1) leads to increased stress-induced cell death and intracellular protein ubiquitination. Studies also suggest that PSMC4, along with TRAP1, regulates the quality of mitochondria targeted proteins. An insertion/deletion mutation in intron 5 of this gene is found in higher frequency in Parkinson′s disease patients than in control. This mutation is less frequent in late-onset PD patients as opposed to early onset PD patients.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Corresponding Antigen APREST86558

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.