biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:20- 1:50
immunogen sequence
MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... FXYD3(5349)
General description
FXYD3 (FXYD domain containing ion transport regulator 3) belongs to the family of FXYD proteins, which form the conserved functional subunit of Na/K-ATPase. FXYD proteins are small, transmembrane proteins which span the membrane only once. They contain their characteristic FXYD (Phe-X-Tyr-Asp) motif as well as three conserved amino acid residues. This family consists of seven members which interact with Na/K-ATPase in a tissue-specific pattern. FXYD3 has two transmembrane domains instead of one, and also has its signal peptide intact. It is normally expressed in uterus, colon, skin and stomach. This protein has two isoforms- FXYD3a and FXYD3b, where FXYD3b has 26 more amino acids in its cytoplasmic region as compared to FXYD3a. This gene maps to human chromosome 19q13.12.
Immunogen
FXYD domain-containing ion transport regulator 3 precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-FXYD3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
FXYD3 (FXYD domain containing ion transport regulator 3) regulates the transport of ions by interacting with and regulating the function of Na/K-ATPase. It either acts as a chloride channel or as a regulator of chloride channel. This protein is differentially expressed in many tumors, where it is overexpressed in prostate and pancreatic cancer, and down-regulated in colon and kidney cancer. Also, it is overexpressed in gastric adenocarcinoma, where it may be involved in tumorigenesis and metastasis. It is up-regulated in glioma, especially in cases of multiple gliomas and female patients. Therefore, it might play a role in glioma development. Down-regulation of FXYD3 might play a role in epithelial-mesenchymal transition, as in the case of lung cancer. It might act as a tumor suppressor, and its inactivation might result in the atypical morphology of cancer cells, as well as the progression of lung cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71685
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
试用我们的 产品选型工具 工具缩小选择范围
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)