biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50- 1:200
immunogen sequence
KTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPR
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SPTLC1(10558)
General description
SPTLC1 (serine palmitoyltransferase, long chain base subunit 1) makes a heterodimer with SPTLC2, which forms the enzyme serine palmitoyltransferase (SPT). SPT resides in the outer membrane of endoplasmic reticulum (ER). SPTLC1 gene maps to human chromosome 9q22.2. This protein has a molecular weight of 53kDa, and is expressed in nucleus, focal adhesions as well as ER. It has multiple putative PDZ binding motifs and a transcription cofactor motif (LXXLL).
Immunogen
Serine palmitoyltransferase 1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Serine palmitoyltransferase (SPT) participates in sphingolipid biosynthesis by catalyzing the first step. It catalyzes the condensation of L-serine with palmitoyl-CoA. SPTLC1 (serine palmitoyltransferase, long chain base subunit 1) also resides in focal adhesions, which suggests that it either plays a role in, or is essential for maintaining the normal morphology of cell. As this protein contains the transcription cofactor motif (LXXLL), it might also act as a transcriptional co-regulator that shuttles between the nucleus and cytoplasm. Mutations in SPTLC1 are associated with hereditary sensory neuropathy type 1 (HSN1), which is characterized by length-dependent axonal degeneration. HSN1 cells show abnormalities in mitochondria and ER stress, which are the results of SPTLC1 mutations. Mutation in Ser331residue of this protein, is linked to the early-onset and severe phenotype of HSN1.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71690
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Still not finding the right product?
Explore all of our products under Anti-SPTLC1 antibody produced in rabbit
— 或者 —
试用我们的 产品选型工具 工具缩小选择范围
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)