biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500
immunogen sequence
SKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLE
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LETM1(3954)
General description
LETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) is a mitochondrial inner membrane protein, and is homologous to yeast protein Mdm38p. It was originally recognized as one of the genes deleted in Wolf-Hirschhorn syndrome. It is a transmembrane protein, which has 14-3-3-like domain in its soluble region, two EF hand Ca2+-binding motifs and two coiled-coil domains. The C-terminal of this protein is hydrophilic and faces the matrix, whereas the N-terminal is hydrophobic and spans the membrane. It has a molecular weight of 83.4kDa. This gene is located on human chromosome 4p16.3.
Immunogen
LETM1 and EF-hand domain-containing protein 1, mitochondrial Precursor (Leucine zipper-EF-hand-containing transmembrane protein 1)
Application
Anti-LETM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
LETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) is responsible for maintaining the shape and volume of mitochondria. It plays a part in mitochondrial translation machinery and mitochondrial biogenesis. It regulates the buffering of mitochondria by controlling Ca2+/H+ antiporter, and also regulates K+/H+ ion exchange. Inactivation of this gene is associated with Wolf-Hirschhorn syndrome, where it leads to aberration in mitochondrial functionality. It is responsible for growth and motor delay, as well as seizures which characterize Wolf-Hirschhorn syndrome. It is up-regulated in various human cancers, and is involved in the tumorigenesis of head and neck squamous cell carcinoma (HNSCC). It also predicts poor prognosis in HNSCC. Up-regulation of this gene leads to suppressed mitochondrial biogenesis and ATP synthesis, leading to necrotic cell death.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST72188
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
法规信息
新产品
此项目有
相关内容
Prestige Antibodies Immunofluorescence Procedure
Ming-Feng Tsai et al.
The Journal of general physiology, 143(1), 67-73 (2013-12-18)
The leucine zipper, EF hand-containing transmembrane protein 1 (Letm1) gene encodes a mitochondrial inner membrane protein, whose depletion severely perturbs mitochondrial Ca(2+) and K(+) homeostasis. Here we expressed, purified, and reconstituted human Letm1 protein in liposomes. Using Ca(2+) fluorophore and
Liyan Chen et al.
BioMed research international, 2014, 850316-850316 (2014-04-02)
Leucine zipper-EF-hand containing transmembrane protein 1 (LETM1) is a mitochondrial inner membrane protein and plays an important role in mitochondrial ATP production and biogenesis. High expression levels of LETM1 have been correlated with numerous human malignancies. This study explored the
Perspectives on: SGP symposium on mitochondrial physiology and medicine: the pathophysiology of LETM1.
Karin Nowikovsky et al.
The Journal of general physiology, 139(6), 445-454 (2012-05-30)
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA011029-25UL | 04061842817337 |
| HPA011029-100UL | 04061836301125 |