biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200
immunogen sequence
GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CLCN2(1181)
General description
CLCN2 (chloride channel, voltage-sensitive 2) is a member of the voltage gated Cl- channels and Cl-/H+ exchangers called ClC family of proteins. The mammalian family consists of nine members including CLCN2. This protein has a ubiquitous expression pattern. It has a predominant expression in brain, pancreas, kidney and intestine. This protein is localized intracellulary in the basolateral membrane of polarized cells. It exists as aggregates on the cell surface, and some proportion of it localized with lipid rafts. This protein consists of two putative phosphorylation sites in its N-terminal, and seven in its C-terminal.
Immunogen
Chloride channel protein 2 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
CLCN2 (chloride channel, voltage-sensitive 2) has a high level of expression in the brain, where it mediates inhibitory γ-aminobutyric acid (GABA) response. It maintains low intracellular Cl- levels, to achieve this. Hyperpolarization of membrane and intracellular anion concentration activate CLCN2, and it is involved in solute transport across epithelial cells. It is expressed in lung epithelia, where it is capable of Cl- transport. It might also be involved in the morphogenesis of lungs. In astrocytes, this protein is involved in the maintenance of extracellular electrolyte homeostasis. Mutation M200fsX231 produces an extremely truncated CLCN2 protein, and might be linked with idiopathic generalized epilepsy. Studies also suggest that this protein might be associated with atherosclerosis and constipation-associated irritable bowel disease. Studies show that the susceptibility to a subset of childhood absence epilepsies maybe linked to CLCN2 gene locus.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST72848
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
法规信息
新产品
此项目有
Ute I Scholl et al.
Nature genetics, 50(3), 349-354 (2018-02-07)
Primary aldosteronism, a common cause of severe hypertension 1 , features constitutive production of the adrenal steroid aldosterone. We analyzed a multiplex family with familial hyperaldosteronism type II (FH-II) 2 and 80 additional probands with unsolved early-onset primary aldosteronism. Eight
Kate Everett et al.
Epilepsy research, 75(2-3), 145-153 (2007-06-21)
In order to assess the chloride channel gene CLCN2 as a candidate susceptibility gene for childhood absence epilepsy, parametric and non-parametric linkage analysis was performed in 65 nuclear pedigrees. This provided suggestive evidence for linkage with heterogeneity: NPL score=2.3, p<0.009;
Jennie Garcia-Olivares et al.
The Journal of physiology, 586(22), 5325-5336 (2008-09-20)
Eukaryotic ClC channels are dimeric proteins with each subunit forming an individual protopore. Single protopores are gated by a fast gate, whereas the slow gate is assumed to control both protopores through a cooperative movement of the two carboxy-terminal domains.
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA014545-25UL | 04061842793686 |
| HPA014545-100UL | 04061836321543 |