biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
recombinant expression
independent
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200
immunogen sequence
FIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQGKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIR
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ARHGEF11(9826)
General description
ARHGEF11 (Rho guanine nucleotide exchange factor (GEF) 11) belongs to the family of Rho guanine nucleotide exchange factors (GEFs). It shares homology to ARHGEF1 and ARHGEF12, and regulates G-protein signaling. This gene maps to human chromosome 1q21, and is expressed in a wide range of tissues such as, adipose tissue, liver, pancreas and muscle. This protein contains a PDZ (PSD-95, Disc-large, ZO1) domain and a G protein signaling (RGS) domain.
Immunogen
Rho guanine nucleotide exchange factor 11 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
ARHGEF11 (Rho guanine nucleotide exchange factor (GEF) 11) induces Rho-GTPases, which modulate G protein signaling. It is involved in the regulation of lipid metabolism, insulin secretion and signaling. It also plays a part in axonal guidance. ARHGEF11 contains an actin-binding domain, and therefore, may play a role in determining the structure of actin cytoskeleton. R1467H variant of this gene might be responsible for increased susceptibility to type 2 diabetes mellitus in Chinese and German Caucasian population. It also interacts with RhoA, myosin II, and actomyosin, to establish cell polarity.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST70693
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
法规信息
新产品
此项目有
Rodolfo Daniel Cervantes-Villagrana et al.
International journal of molecular sciences, 24(21) (2023-11-14)
Oncogenic Gαq causes uveal melanoma via non-canonical signaling pathways. This constitutively active mutant GTPase is also found in cutaneous melanoma, lung adenocarcinoma, and seminoma, as well as in benign vascular tumors, such as congenital hemangiomas. We recently described that PDZ-RhoGEF
Alejandro Castillo-Kauil et al.
The Journal of biological chemistry, 295(50), 16920-16928 (2020-10-08)
Gα proteins promote dynamic adjustments of cell shape directed by actin-cytoskeleton reorganization via their respective RhoGEF effectors. For example, Gα13 binding to the RGS-homology (RH) domains of several RH-RhoGEFs allosterically activates these proteins, causing them to expose their catalytic Dbl-homology
Yvonne Böttcher et al.
Journal of human genetics, 53(4), 365-367 (2008-01-31)
The human rho guanine nucleotide exchange factor 11 (ARHGEF11) functions as an activator of rho GTPases and is supposed to influence insulin signalling. We investigated the effects of the previously reported R1467H variant in individual's susceptibility to type 2 diabetes
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA014658-25UL | 04061842793839 |
| HPA014658-100UL | 04061833815120 |