biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
rat, human, mouse
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500
immunogen sequence
DPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHV
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SCAMP2(10066)
General description
SCAMP2 (secretory carrier membrane protein 2) belongs to the SCAMP family of highly conserved integral membrane proteins, which are involved in cell surface recycling pathways). SCAMP2 is one of the two isoforms of SCAMP, the other being SCAMP1, and has a molecular weight of 39kDa. It has a wide range of tissue expression. It is a transmembrane protein, which contains a cytoplasmic N-terminal, cytoplasmic C-terminal tail and four transmembrane regions. It contains NHE5 (Na+/H+ exchanger)-binding sites in both its N- and C-termini. It also contains the characteristic E-peptide of SCAMP proteins, within the second and third transmembrane helices. This protein resides in endosomes, other recycling organelles, as well as plasma membrane.
Immunogen
Secretory carrier-associated membrane protein 2 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
SCAMP2 (secretory carrier membrane protein 2) is involved in Ca2+-dependent granule exocytosis, and is a part of the later stages of membrane fusion. It controls the formation of membrane fusion pores, by sequestering phosphatidylinositol 4,5-bisphosphate (PIP2) within membranes. It interacts with PIP2 via a hydrophobic sequence CWYRPIYKAFR, present in its structure. It interacts with serotonin and dopamine transporters, and controls their subcellular distribution and their surface expression. It interacts with NHE5, which is a Na+/H+ exchanger highly expressed in brain, through its cytoplasmic N- and C-termini. This way, it regulates the movement of NHE5 through recycling endosomes, and its cell surface targeting, in the presence of Arf6 (ADP-ribosylation factor 6). The E-peptide of SCAMP2 protein is a potent inhibitor of exocytosis during the later stages.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST73121
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
法规信息
新产品
此项目有
相关内容
Prestige Antibodies Immunofluorescence Procedure
Haini Liao et al.
Biochemistry, 46(38), 10909-10920 (2007-08-24)
Secretory carrier membrane protein 2 (SCAMP2) functions in late steps of membrane fusion in calcium-dependent granule exocytosis. A basic/hydrophobic peptide segment within SCAMP2 (SCAMP2 E: CWYRPIYKAFR) has been implicated in this function and shown to bind and sequester phosphatidylinositol 4,5-bisphosphate
Heidi Kaastrup Müller et al.
The Journal of biological chemistry, 281(39), 28901-28909 (2006-07-28)
The serotonin transporter (SERT) belongs to the SLC6 family of sodium- and chloride-dependent neurotransmitter transporters responsible for uptake of amino acids and biogenic amines from extracellular spaces. Their activities and subcellular distributions are regulated by various cellular mechanisms, including interactions
Lixia Liu et al.
Molecular biology of the cell, 13(12), 4266-4278 (2002-12-12)
In secretory carrier membrane proteins (SCAMPs), the most conserved structural segment is between transmembrane spans 2 and 3, facing the cytosol. A synthetic peptide, CWYRPIYKAFR (E peptide), from this segment of SCAMP2 potently inhibits exocytosis in permeabilized neuroendocrine (PC12) cells.
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA014699-25UL | 04061842793891 |
| HPA014699-100UL | 04061836321680 |