Monoclonal Anti-NOS1AP antibody produced in mouse

This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms. (provided by RefSeq)

NOS1AP (NP_055512.1, 99 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQL

Solution in phosphate buffered saline, pH 7.4