Monoclonal Anti-DUSP16, (C-terminal) antibody produced in mouse

The activation of mitogen-activated protein kinase (MAPK) cascades transduces various extracellular signals to the nucleus to induce gene expression, cell proliferation, differentiation, cell cycle arrest, and apoptosis. For full activation of MAPKs, dual-specificity kinases phosphorylate both threonine and tyrosine residues in MAPK TXY motifs. MKPs are dual-specificity phosphatases that dephosphorylate the TXY motif, thereby negatively regulating MAPK activity.[supplied by OMIM

DUSP16 (NP_085143.1, 561 a.a. ~ 665 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS

Solution in phosphate buffered saline, pH 7.4