Monoclonal Anti-USP5 antibody produced in mouse

Mouse monoclonal antibody raised against a partial recombinant USP5.

USP5 (NP_003472, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA

Monoclonal Anti-USP5 antibody produced in mouse is suitable for indirect ELISA and western blot analysis.

USP5 (ubiquitin specific peptidase 5) is a zinc-binding, multidomain, deubiquitinating protein belonging to the ubiquitin-specific protease (USP) family. It comprises of a zinc finger (ZnF) domain responsible for catalytic activity. USP5 has been reported as a putative p53 target gene in cancer treatment. The suppressed expression of USP5 increases the level and transcriptional activity of p53.

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.