Monoclonal Anti-SOCS3 antibody produced in mouse

Suppressor of cytokine signaling 3 (SOCS3) is encoded by the gene mapped to human chromosome 17q25.3.The encoded protein belongs to the SOCS protein family.

SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Suppressor of cytokine signaling 3 (SOCS3) plays a vital role in cytokine signaling. The encoded protein has an ability to bind and inhibit janus kinases (JAKs), turning off signal transducers and activators of transcription 3 (STAT3) signaling in response to interferon (IFN)-6 stimulation. Downregulated expression of the gene enhance the growth and metastasis of colorectal cancer (CRC). Thus, targeting IL-6/STAT3/SOCS3 signaling pathway can be considered as a potent therapeutic strategy for CRC.

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.