Monoclonal Anti-ANAPC2, (C-terminal) antibody produced in mouse

A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The product of this gene is a component of the complex and shares sequence similarity with a recently identified family of proteins called cullins, which may also be involved in ubiquitin-mediated degradation. (provided by RefSeq)

ANAPC2 (NP_037498, 716 a.a. ~ 822 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS

Solution in phosphate buffered saline, pH 7.4