The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

P2RX5 (NP_002552.2, 1 a.a. ~ 422 a.a) full-length human protein.

Sequence
MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST

Anti-P2RX5 antibody produced in mouse is suitable for western blot.

P2RX5 (Purinergic receptor P2X, ligand-gated ion channel, 5) functions as a ATP-gated ion channel. In humans, it is predicted to form trimeric structure with another member of this family, P2X1. Upregulated P2RX5 expression has been observed during CD4⁺ T cell activation. It has been studied that activated P2RX5 plays an important role in the T cell polarity and immunoregulation, when it is recruited to the surface of the activated CD4⁺ T cells.

Solution in phosphate buffered saline, pH 7.4