ANTI-ZNF207 antibody produced in mouse

Zinc finger protein 207 (ZNF207) consists of a N-terminal zinc finger domain and a conserved GLE-2-binding sequence (GLEBS) motif, which helps BUB3 (budding uninhibited by benzimidazoles 3) binding. The gene is located on human chromosome 17q11.2.

ZNF207 (NP_003448, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ

Zinc finger protein 207 (ZNF207) maintains BUB3 (budding uninhibited by benzimidazoles 3) protein stability and chromosome congression. This protein interacts with microtubules and maintains chromosome alignment. It also helps in the loading of Bub3 protein to the kinetochores. ZNF207 is essential for maintaining the viability of glioblastoma stem cells.

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.