Anti-COL9A3 (C-terminal) antibody produced in rabbit

This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3.

Synthetic peptide directed towards the C terminal region of human COL9A3

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Synthetic peptide located within the following region: PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.