Monoclonal Anti-DPYS antibody produced in mouse

Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria. (provided by RefSeq)

The gene DPYS (dihydropyrimidinase) is mapped to human chromosome 8q22. It is mainly expressed in the liver and kidney cells.

DPYS (NP_001376, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP

DPYS (dihydropyrimidinase) is an enzyme of the pyrimidine degradation pathway and is responsible for the ring opening of 5,6-dihydrouracil and 5,6-dihydrothymine. Mutations in the DPYS gene can lead to dihydropyrimidinase deficiency, associated with a large accumulation of dihydrouracil and dihydrothymine in urine, blood and cerebrospinal fluid. Methylation pattern in DPYS gene might predict prostate cancer-related mortality.{33)

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services