Monoclonal Anti-ABCF2 antibody produced in mouse

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants. (provided by RefSeq)

ABCF2 (AAH01661, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS

ATP binding cassette subfamily F member 2 (ABCF2) has been shown to bind to a-actinin-4 (ACTN4). It suppresses the activity of a channel named volume-sensitive outwardly rectifying anion channel (VSOR), which takes part in the efflux of chloride ions in epithelial cells. It has been reported that ABCF2 may be a prognostic marker for ovarian clear cell ovarian adenocarcinoma.

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services