biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
124 kDa
species reactivity
rat, guinea pig, dog, human, bovine, horse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SREBF2(6721)
Immunogen
Synthetic peptide directed towards the middle region of human SREBF2
Application
Anti- SREBF2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
Sterol Regulatory Element-Binding Proteins (SREBPs) are transcription factors that are required for metabolic reprogramming and membrane synthesis in CD8+ T cells during the transition from quiescence to activation. SREBF2 is a transcriptional regulator of genes involved in cholesterol biosynthesis and lipid homeostasis.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Guido T Bommer et al.
Cell metabolism, 13(3), 241-247 (2011-03-02)
The sterol regulatory element-binding factor-2 (SREBF2) gene is a bifunctional locus encoding SREBP-2, a well-known transcriptional regulator of genes involved in cholesterol biosynthesis, and microRNA-33a, which has recently been shown to reduce expression of proteins involved in export of cholesterol
Yoko Kidani et al.
Nature immunology, 14(5), 489-499 (2013-04-09)
Newly activated CD8(+) T cells reprogram their metabolism to meet the extraordinary biosynthetic demands of clonal expansion; however, the signals that mediate metabolic reprogramming remain poorly defined. Here we demonstrate an essential role for sterol regulatory element-binding proteins (SREBPs) in
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service