Skip to Content
Merck
CN

AV32548

Sigma-Aldrich

Anti-GATA3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-GATA binding protein 3

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

48 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunofluorescence: suitable
immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GATA3(2625)

General description

GATA3 facilitates the expression of Th2 gene in CD4+ T cells. Studies in mice have reported that GATA3 disruptions can induce defects in nervous system and fetal liver hematopoiesis.
Rabbit Anti-GATA3 antibody recognizes chicken, bovine, canine, pig, human, mouse, and rat GATA3.
Rabbit polyclonal anti-GATA3 antibody reacts with chicken, bovine, canine, pig, human, mouse, and rat GATA binding protein 3 transcription factors.
Trans-acting T-cell-specific transcription factor GATA binding protein 3 (GATA3) is a tissue specific transcription factor involved in endothelial cell biology and the regulation of T-cell development. GATA3 plays a role in the development, survival, and function of innate lymphoid cell (ILC) subpopulations. GATA3 differentially regulates T(h)1/T(h)2 differentiation. It promotes the secretion of factors such as IL-4, IL-5 and IL-13 from Th2 cells.

Immunogen

Synthetic peptide directed towards the C terminal region of human GATA3

Application

Rabbit Anti-GATA3 antibody can be used for western blot (0.2-2.0μg/ml) and IHC (4-8μg/ml) applications.
Rabbit polyclonal anti-GATA3 antibody is used to tag GATA binding protein 3 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GATA binding protein 3 in endothelial and T-cell biology and differentiation.

Biochem/physiol Actions

Trans-acting T-cell specific transcription factor GATA-3 is a member of GATA family of transcription factors that regulates development of multiple tissues. It is an important transcription factor in regulating human Th2 cell differentiation in vivo.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

W Zheng et al.
Cell, 89(4), 587-596 (1997-05-16)
CD4 T cells potentiate the inflammatory or humoral immune response through the action of Th1 and Th2 cells, respectively. The molecular basis of the differentiation of these cells from naive T cell precursors is, however, unclear. We found that GATA-3
P P Pandolfi et al.
Nature genetics, 11(1), 40-44 (1995-09-01)
GATA-3 is one member of a growing family of related transcription factors which share a strongly conserved expression pattern in all vertebrate organisms. In order to elucidate GATA-3 function using a direct genetic approach, we have disrupted the murine gene

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service