Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
49 kDa
species reactivity
rabbit, mouse, horse, dog, rat, human, guinea pig, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MYBL1(4603)
General description
Rabbit polyclonal anti-MyBL1 antibody reacts with chicken, canine, human, mouse, and rat v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 transcription factors.
v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 (MyBL1) which is expressed predominantly as a tissue-specific transcription factor in spermatocytes and breast epithelial cells is a male-specific regulator of several crucial meiotic processes. MYBL1 is a master regulator of meiotic genes that are involved in multiple processes in spermatocytes, particularly those required for cell cycle progression through pachynema. MYBL1 directs germ cell-specific activation via the CRE site of certain genes.
Immunogen
Synthetic peptide directed towards the middle region of human MYBL1
Application
Rabbit Anti-MyBL1 antibody can be used for IHC (4-8μg/ml) and western blot (2.5μg/ml) applications.
Rabbit polyclonal anti-MyBL1 antibody is used to tag v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 in spermatocyte development.
Biochem/physiol Actions
MYBL1 is strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5′-YAAC[GT]G-3′. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service