AV34684
Anti-MEIS2 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Meis homeobox 2
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
52 kDa
species reactivity
bovine, rabbit, human, guinea pig, horse, dog, rat, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MEIS2(4212)
Related Categories
General description
MEIS2 is a homeobox protein that is involved in the development of lens and retina. It is also known to compete with Tle4 for Otx2 binding and modulates tectal fate.
Rabbit Anti-MEIS2 antibody recognizes chicken, human, mouse, rat, zebrafish, canine, and bovine MEIS2.
Rabbit Anti-MEIS2 antibody recognizes chicken, human, mouse, rat, zebrafish, canine, and bovine MEIS2.
Immunogen
Synthetic peptide directed towards the N terminal region of human MEIS2
Application
Rabbit Anti-MEIS2 antibody is suitable for western blot (1.25 μg/ml) and IHC (4-8 μg/ml) applications.
Biochem/physiol Actions
MEIS2 encodes a homeobox protein belonging to the TALE (′three amino acid loop extension′) family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Zsuzsa Agoston et al.
Development (Cambridge, England), 136(19), 3311-3322 (2009-09-09)
The transcription factor Otx2 is expressed throughout the anterior neuroectoderm and is required for the formation of all forebrain- and midbrain-derived structures. The molecular determinants that cooperate with Otx2 to subdivide its expression domain into distinct functional units are, however
Ivan Conte et al.
Proceedings of the National Academy of Sciences of the United States of America, 107(35), 15491-15496 (2010-08-18)
MicroRNAs (miRNAs) are small noncoding RNAs that have important roles in the regulation of gene expression. The roles of individual miRNAs in controlling vertebrate eye development remain, however, largely unexplored. Here, we show that a single miRNA, miR-204, regulates multiple
Laura Remesal et al.
Development (Cambridge, England), 147(8) (2020-03-12)
Neuronal specification is a protracted process that begins with the commitment of progenitor cells and culminates with the generation of mature neurons. Many transcription factors are continuously expressed during this process but it is presently unclear how these factors modify
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service