Skip to Content
Merck
CN

AV35341

Sigma-Aldrich

Anti-GRIK2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Glutamate receptor, ionotropic, kainate 2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

98 kDa

species reactivity

bovine, guinea pig, human, rabbit, dog, horse, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GRIK2(2898)

General description

GRIK2 is a ligand-gated, ion channel glutamate receptor that belongs to the kainite family. Genetic variations in GRIK2 have been linked to mental retardation, mania and obsessive compulsive disorder (OCD).
Rabbit Anti-GRIK2 antibody recognizes canine, human, mouse, rat, bovine, and zebrafish GRIK2.

Immunogen

Synthetic peptide directed towards the C terminal region of human GRIK2

Application

Rabbit Anti-GRIK2 antibody is suitable for western blot applications at a concentration of 0.125 μg/ml.

Biochem/physiol Actions

This gene, GRIK2, encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Richard Delorme et al.
Neuroreport, 15(4), 699-702 (2004-04-20)
Several lines of evidence suggest that obsessive compulsive disorder (OCD) could be the consequence of glutamatergic dysfunction. We performed a case-control study in 156 patients and 141 controls and the transmission disequilibrium test in 124 parent-offspring trios to search for
Mohammad Mahdi Motazacker et al.
American journal of human genetics, 81(4), 792-798 (2007-09-12)
Nonsyndromic mental retardation is one of the most important unresolved problems in genetic health care. Autosomal forms are far more common than X-linked forms, but, in contrast to the latter, they are still largely unexplored. Here, we report a complex
G Shaltiel et al.
Molecular psychiatry, 13(9), 858-872 (2008-03-12)
The glutamate receptor 6 (GluR6 or GRIK2, one of the kainate receptors) gene resides in a genetic linkage region (6q21) associated with bipolar disorder (BPD), but its function in affective regulation is unknown. Compared with wild-type (WT) and GluR5 knockout

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service