AV39623
Anti-CBLL1 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
55 kDa
species reactivity
bovine, rat, human, mouse, horse, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... CBLL1(79872)
Related Categories
General description
CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is a cbl-like ubiquitin ligase of E-cadherin complex. It is expressed in the neurons of central nervous system.
Rabbit Anti-CBLL1 antibody recognizes human, mouse, rat, zebrafish, canine, and chicken CBLL1.
Rabbit Anti-CBLL1 antibody recognizes human, mouse, rat, zebrafish, canine, and chicken CBLL1.
Immunogen
Synthetic peptide directed towards the C terminal region of human CBLL1
Application
Rabbit Anti-CBLL1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.
Biochem/physiol Actions
CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is an E-cadherin binding protein involved in the ubiquitination of E-cadherin and regulation of E-cadherin complex endocytosis. During ubiquitination, it directly binds to the cytoplasmic domain of E-cadherin. It has been reported in a study that CBLL1 may play a role in neuronal apoptosis and in LPS (Lipopolysaccharide) administration. CBLL1 also have been predicted as a regulator of cell proliferation.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Maohong Cao et al.
Journal of molecular histology, 44(2), 135-145 (2012-11-20)
CBLL1 (Casitas B-lineage lymphoma-transforming sequence-like protein 1) also known as Hakai, was originally identified as an E3 ubiquitin-ligase for the E-cadherin complex. Recent data have provided evidences for novel biological functional role of CBLL1 during tumor progression and other diseases.
Maria-Dolores Fernandez-Garcia et al.
Journal of virology, 85(6), 2980-2989 (2010-12-31)
The ubiquitin ligase CBLL1 (also known as HAKAI) has been proposed to be a critical cellular factor exploited by West Nile virus (WNV) for productive infection. CBLL1 has emerged as a major hit in a recent RNA interference screen designed
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service