Skip to Content
Merck
CN

AV40465

Sigma-Aldrich

Anti-XPO1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CRM1, Anti-DKFZp686B1823, Anti-Exportin 1 (CRM1 homolog, yeast)

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

123 kDa

species reactivity

rat, mouse, pig, horse, rabbit, human, dog, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... XPO1(7514)

General description

Exportin 1 (CRM1 homolog, yeast) (XPO1, CRM1) is a nuclear export protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1controls cell function by regulating the localization of factors such as Rev, U snRNAs, kinetoplastid spliced leader RNA, cyclin B, MPAK, MAPKAP kinase2 and hexokinase 2 (Hxk2).

Immunogen

Synthetic peptide directed towards the C terminal region of human XPO1

Application

Anti-XPO1 polyclonal antibody is used to tag exportin 1 (CRM1 homolog, yeast) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of exportin 1 management of cell function via control of the localization of regulatory proteins, splicing proteins and enzymes.

Biochem/physiol Actions

Anti-XPO1 polyclonal antibody reacts with bovine, canine, human, mouse, and rat exportin 1 (CRM1 homolog, yeast) proteins.
XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.The protein encoded by this gene mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service