AV41198
Anti-DND1 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Dead end homolog 1 (zebrafish), Anti-MGC34750, Anti-RBMS4
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
39 kDa
species reactivity
rat, mouse, human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... DND1(373863)
Related Categories
General description
Dead end homolog 1 (zebrafish) is an RNA binding protein found in primordial germ cells during embryogenesis. DND1 is essential for germ cell survival. Dnd1 appears to have a critical role in germ-cell and germ cell-tumor development. Dnd1 acts, at least in part, by protecting certain mRNAs from micro-RNA (miRNA)-mediated repression.
Immunogen
Synthetic peptide directed towards the C terminal region of human DND1
Application
Anti-DND1 polyclonal antibody is used to tag dead end homolog 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of dead end homolog 1 proteins in germ-cell and germ cell-tumor development, especially at the level of miRNA mediated repression of mRNA transcription.
Biochem/physiol Actions
Anti-DND1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine dead end homolog 1 proteins.
DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Characterization of potential spermatogonia biomarker genes in the European eel (Anguilla anguilla).
Marta Blanes-García et al.
Fish physiology and biochemistry (2024-04-19)
Identification of specific molecular markers for spermatogonial stem cells in teleost is crucial for enhancing the efficacy of reproductive biotechnologies in aquaculture, such as transplantation and surrogate production in fishes. Since it is not yet possible to distinguish spermatogonial stem
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service