Skip to Content
Merck
CN

AV46276

Anti-ASF1B antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-ASF1 anti-silencing function 1 homolog B (S. cerevisiae), Anti-CIA-II, Anti-FLJ10604

Sign In to View Organizational & Contract Pricing.

Select a Size

About This Item

NACRES:
NA.41
UNSPSC Code:
12352203

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-ASF1B antibody produced in rabbit, affinity isolated antibody

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

22 kDa

species reactivity

rat, guinea pig, mouse, human, bovine, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_060624

UniProt accession no.

Q9NVP2

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

100

Gene Information

human ... ASF1B(55723)

Related Categories

Application

Anti-ASF1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Biochem/physiol Actions

ASF1B [anti-silencing function 1 homolog B (S. cerevisiae)] gene encodes for a protein that belongs to H3/H4 family of histone chaperone proteins and facilitates the histone deposition as well as histone exchange and removal during nucleosome assembly and disassembly. ASF1B interacts with HCF-1 and regulates the progression of cellular DNA replication forks through chromatin reorganization. It also stimulates the viral DNA replication by combining Asf1b to DNA replication components. Additionally, depletion of both the histone chaperones ASF1a and ASF1b in human cells induces hallmark of alternative lengthening of telomeres (ALT) in primary as well as cancer cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human ASF1B

Other Notes

Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC16281

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Hua Peng et al.
Proceedings of the National Academy of Sciences of the United States of America, 107(6), 2461-2466 (2010-02-06)
The cellular transcriptional coactivator HCF-1 interacts with numerous transcription factors as well as other coactivators and is a component of multiple chromatin modulation complexes. The protein is essential for the expression of the immediate early genes of both herpes simplex
Angélique Galvani et al.
Molecular and cellular biology, 28(11), 3672-3685 (2008-04-02)
Histone chaperones have been implicated in nucleosome assembly and disassembly as well as histone modification. ASF1 is a highly conserved histone H3/H4 chaperone that synergizes in vitro with two other histone chaperones, chromatin assembly factor 1 (CAF-1) and histone repression
Roderick J O'Sullivan et al.
Nature structural & molecular biology, 21(2), 167-174 (2014-01-15)
The mechanism of activation of the alternative lengthening of telomeres (ALT) pathway of mammalian chromosome-end maintenance has been unclear. We have now discovered that co-depletion of the histone chaperones ASF1a and ASF1b in human cells induced all hallmarks of ALT

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service