Skip to Content
Merck
CN

AV46800

Sigma-Aldrich

Anti-ST3GAL2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Gal-NAc6S, Anti-SIAT4B, Anti-ST3 β-galactoside α-2,3-sialyltransferase 2, Anti-ST3GALII, Anti-ST3GalA.2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

40 kDa

species reactivity

dog, guinea pig, rat, human, mouse, horse, bovine, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ST3GAL2(6483)

Immunogen

Synthetic peptide directed towards the C terminal region of human ST3GAL2

Application

Anti-ST3GAL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) gene encodes a type II membrane protein that belongs to the glycosyltransferase family 29. It plays a pivotal role in transfering the sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL2 is a MSGb5 (stage-specific embryonic antigen-4) synthase and increased expression of ST3Gal II facilitates as a marker for renal carcinogenesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Seiichi Saito et al.
The Journal of biological chemistry, 278(29), 26474-26479 (2003-04-30)
Monosialosyl globopentaosylceramide (MSGb5), originally described as stage-specific embryonic antigen-4, is expressed in testicular germ cell tumors and in aggressive cases of human renal cell carcinoma (RCC). Clarification of the molecular mechanisms regulating synthesis of MSGb5 is very important to understand
Akiyoshi Taniguchi et al.
Biochemical and biophysical research communications, 300(2), 570-576 (2002-12-31)
In this report, we describe transcriptional regulation of the human Gal beta 1,3 GalNAc alpha 2,3-sialyltransferase II (hST3Gal II) gene. The results of 5'-RACE showed that the forms of two mRNAs differed only in the 5'-untranslated region (Types 1 and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service