Skip to Content
Merck
CN

AV46856

Anti-CHIC2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BTL, Anti-Cysteine-rich hydrophobic domain 2, Anti-MGC21173

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

19 kDa

species reactivity

guinea pig, human, bovine, rat, dog, mouse, horse, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CHIC2(26511)

Related Categories

Immunogen

Synthetic peptide directed towards the N terminal region of human CHIC2

Application

Anti-CHIC2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Biochem/physiol Actions

CHIC2 (cysteine-rich hydrophobic domain 2) gene encodes for a 165 amino acid containing membrane protein that belongs to the CHIC family. CHIC2 is associated with vesicular structures and the plasma membrane, signifying that it may regulate exocytosis. CHIC2 gene is also involved in a chromosomal translocation occurring in acute myeloid leukemias.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

J Cools et al.
FEBS letters, 492(3), 204-209 (2001-03-21)
We recently cloned the CHIC2 gene (previously BTL) by virtue of its involvement in a chromosomal translocation t(4;12)(q11;p13) occurring in acute myeloid leukemias. In this study we show that CHIC2 is a member of a highly conserved family of proteins

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service