Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
20 kDa
species reactivity
rat, mouse, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IL22(50616)
General description
Interleukin 22 (IL-22) belongs to the IL10 family of T-cell associated cytokines, highly expressed in αβ and γδ T cells, as well as in innate lymphoid cells. Inflammatory cells associated with the thymus, pancreas, synovium, skin, and gut secrete IL-22. The Il-22 gene is localized on human chromosome 12q15.
Immunogen
Synthetic peptide directed towards the C terminal region of human IL22
Application
Anti-IL22 antibody produced in rabbit has been used in immunoblotting (1:1000).
Biochem/physiol Actions
Interleukin 22 (IL-22) plays a key role in cell proliferation, cellular defense, and tissue regeneration, It shows potential in wound healing and to treat gastrointestinal (GI)-related illnesses. Higher levels of IL-22 is observed in systemic lupus erythematosus, vitiligo, multiple sclerosis, etc.
Interleukin 22 (IL22) belongs to the interleukin 10 (IL-10) family. It is a cytokine that contributes to the inflammatory response in vivo. IL22 cellular effects are mediated by a heterodimeric receptor made up of IL22 and IL-10Rβ. IL22 signaling mediates proliferation of epithelial cells during inflammation mainly by the activation of signal transducer and activator of transcription 1 (STAT1) and STAT3 signaling.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Olivia B Parks et al.
Frontiers in cell and developmental biology, 3, 85-85 (2016-01-23)
Interleukin (IL)-22 is a member of the IL-10 family of cytokines that has been extensively studied since its discovery in 2000. This review article aims to describe the cellular sources and signaling pathways of this cytokine as well as the
Kerstin Wolk et al.
European journal of immunology, 36(5), 1309-1323 (2006-04-19)
IL-22 is an IFN-IL-10 cytokine family member, which is produced by activated Th1 and NK cells and acts primarily on epithelial cells. Here we demonstrate that IL-22, in contrast to its relative IFN-gamma, regulates the expression of only a few
Lauren A Zenewicz
ImmunoHorizons, 2(6), 198-207 (2019-04-26)
IL-22 is a critical cytokine in modulating tissue responses during inflammation. IL-22 is upregulated in many chronic inflammatory diseases, making IL-22 biology a potentially rewarding therapeutic target. However, this is complicated by the dual-natured role of IL-22 in inflammation, as
Jane A Lindborg et al.
Cell reports, 34(9), 108777-108777 (2021-03-04)
Adult mammalian central nervous system (CNS) trauma interrupts neural networks and, because axonal regeneration is minimal, neurological deficits persist. Repair via axonal growth is limited by extracellular inhibitors and cell-autonomous factors. Based on results from a screen in vitro, we evaluate
Lauren A Zenewicz et al.
European journal of immunology, 38(12), 3265-3268 (2008-11-20)
IL-22 is a Th17 T-cell-associated cytokine that is highly expressed during chronic inflammation. IL-22 receptor expression is absent on immune cells, but is instead restricted to the tissues, providing signaling directionality from the immune system to the tissues. Through Stat3
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service