Skip to Content
Merck
CN

AV50222

Sigma-Aldrich

Anti-GALNT13 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FLJ16031, Anti-FLJ41157, Anti-GalNAc-T13, Anti-H_NH0187G20.1, Anti-KIAA1918, Anti-MGC119459, Anti-MGC119461

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

64 kDa

species reactivity

mouse, rabbit, dog, horse, bovine, rat, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... GALNT13(114805)

Related Categories

General description

GALNT13 is particularly expressed in fetal brain, adult cerebellum, cerebral cortex and whole brain. GALNT13 transcripts are exclusively present in neuroblastoma cells.

Immunogen

Synthetic peptide directed towards the N terminal region of human GALNT13

Application

Anti-GALNT13 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

GALNT13 (Polypeptide N-acetylgalactosaminyltransferase 13) catalyzes the O-linked glycosylation of mucins by transfer of N-acetylgalactosamine (GalNAc) with an α-linkage to a serine or threonine residue in protein. It may act as a molecular marker for bone marrow dissemination in human neuroblastoma. GALNT13 is linked to sickle cell disease-associated increased tricuspid regurgitation jet velocity.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nora Berois et al.
Clinical chemistry, 52(9), 1701-1712 (2006-07-29)
To identify new molecular markers of bone marrow dissemination in human neuroblastoma (NB), we studied the transcriptome profiles of malignant neuroblasts established from the human MYCN-amplified IGR-N-91 model. This experimental model includes human neuroblastoma cells derived from a subcutaneous stage
Yan Zhang et al.
The Journal of biological chemistry, 278(1), 573-584 (2002-10-31)
To date, 10 members of the UDP-N-acetyl-alpha-d-galactosamine:polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family have been cloned and analyzed in human. In this study, we cloned and analyzed a novel human pp-GalNAc-T from an NT2 cell cDNA library, and we named it pp-GalNAc-T13. In
Ankit A Desai et al.
American journal of respiratory and critical care medicine, 186(4), 359-368 (2012-06-09)
An increased tricuspid regurgitation jet velocity (TRV > 2.5 m/s) and pulmonary hypertension defined by right heart catheterization both independently confer increased mortality in sickle cell disease (SCD). We explored the usefulness of peripheral blood mononuclear cell-derived gene signatures as

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service