Skip to Content
Merck
CN

HPA000288

Anti-ACE2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ACE-related carboxypeptidase antibody produced in rabbit, Anti-ACEH antibody produced in rabbit, Anti-Angiotensin-converting enzyme 2 precursor antibody produced in rabbit, Anti-Angiotensin-converting enzyme homolog antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
immunoblotting
immunohistochemistry
Species reactivity:
human
Citations:
33
Technique(s):
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
Uniprot accession no.:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-ACE2 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... ACE2(59272)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-ACE2 antibody produced in rabbit has been used for immunohistochemistry at a dilution of 1:500-1:1000. It has also been used in western blotting at a working concentration of 0.04-0.4 μg/ml.

Biochem/physiol Actions

Angiotensin-converting enzyme (ACE2) catalyzes the degradation of angiotensin (Ang) II to Ang (1-7). The deficiency ACE2 or its inhibition by ang II is implicated in the pathogenesis of cardiac hypertrophy and myocardial dysfunction. ACE2 is multifunctional and is incapable of hydrolyzing bradykinin. In patients with CTD (connective tissue disease), serum autoantibodies suppress ACE2, which leads to a decrease in the physiological levels of vasoprotective agent Ang (1-7) in the vascular milieu. Activation or administration of ACE2 in patients with CTD may serve as a therapeutic method for treating pulmonary arterial hypertension (PAH), or persistent digital ischemia. It also plays a regulatory role in lung diseases and pulmonary fibrosis. The human ACE2 receptor is recognized by severe acute respiratory syndrome (SARS-CoV) coronaviruses (CoVs) 2. This interaction paves a way for the transmission of infection.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

General description

Angiotensin-converting enzyme 2 (ACE2) is mapped to human chromosome Xp22.2. It is a homolog of ACE and shares 42% sequence identity. ACE2 is expressed in kidney, gastrointestinal and cardiovascular tissues.
Angiotensin-converting enzyme-2 (ACE2) is a homolog of angiotensin-I converting enzyme (ACE). ACE2 is a member of the renin-angiotensin system (RAS) which performs functions similar to carboxypeptidase. This 805 amino acid protein is localized in human kidney. The ACE2 gene is located at human chromosome Xp22.2. It contains a N-terminal peptidase domain (PD) and the C-terminal collectrin-like domain (CLD).

Immunogen

Angiotensin-converting enzyme 2 precursor recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST74018

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Angiotensin-converting enzyme 2 (ACE2), but not ACE, is preferentially localized to the apical surface of polarized kidney cells.
Warner FJ
The Journal of Biological Chemistry, 280, 39353-39362 (2005)
Laale F Alawi et al.
Frontiers in pharmacology, 11, 602985-602985 (2021-03-13)
Activation of the renin angiotensin system plays a pivotal role in the regulation of blood pressure, which is mainly attributed to the formation of angiotensin-II (Ang II). The actions of Ang II are mediated through binding to the Ang-II type
Harlan Barker et al.
PloS one, 15(10), e0240647-e0240647 (2020-10-29)
The World Health Organization declared the COVID-19 epidemic a public health emergency of international concern on March 11th, 2020, and the pandemic is rapidly spreading worldwide. COVID-19 is caused by a novel coronavirus SARS-CoV-2, which enters human target cells via
Renal ACE2 expression in human kidney disease.
Lely AT
The Journal of Pathology, 204, 587-593 (2004)
ACE2 and COVID-19 and the resulting ARDS
Zhang X, et al.
Postgraduate Medical Journal (2020)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service