Skip to Content
Merck
CN

HPA001462

Anti-Amyloid Precursor Protein (APP) Antibody

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

Synonym(s):

Anti-ABPP antibody produced in rabbit, Anti-APPI antibody produced in rabbit, Anti-Alzheimer disease amyloid protein antibody produced in rabbit, Anti-Amyloid β A4 protein precursor antibody produced in rabbit, Anti-CVAP antibody produced in rabbit, Anti-Cerebral vascular amyloid peptide antibody produced in rabbit, Anti-PN-II antibody produced in rabbit, Anti-PreA4 antibody produced in rabbit, Anti-Protease nexin-II antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
MDL number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC, WB
Citations:
4
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


Product Name

Anti-APP antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200-1:500, western blot: 0.04-0.4 μg/mL

immunogen sequence

ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... APP(351)

Immunogen

Amyloid β A4 protein precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

APP (amyloid beta (A4) precursor protein) gene encodes a protein that functions as a cell surface receptor. This transmembrane precursor protein is cleaved by secretases to form a number of peptides involved in various processes. Some peptides are secreted and they promote transcriptional activation by binding to the acetyltransferase complex APBB1/TIP60. Some peptides also form the protein basis of the amyloid plaques that are characteristic of Alzheimer disease brain. Defects in this gene are associated with autosomal dominant Alzheimer disease and cerebroarterial amyloidosis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST77493

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
低风险生物材料

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library


Related Content

Prestige Antibodies Immunofluorescence Procedure


Guido N Vacano et al.
Current gerontology and geriatrics research, 2012, 717315-717315 (2012-03-31)
Down syndrome is a complex condition caused by trisomy of human chromosome 21. The biology of aging may be different in individuals with Down syndrome; this is not well understood in any organism. Because of its complexity, many aspects of
Ryoko Oi et al.
Breast cancer : basic and clinical research, 10, 211-221 (2016-12-17)
The double-stranded RNA-binding protein TARBP2 has been suggested to act as an upstream regulator of breast cancer metastasis by destabilizing transcripts of the possible metastasis suppressors amyloid precursor protein (APP) and ZNF395. We examined this hypothesis by immunostaining of TARBP2
J Wohlschlegel et al.
Scientific reports, 11(1), 17210-17210 (2021-08-28)
Integral Membrane Protein 2 B (ITM2B) is a type II ubiquitous transmembrane protein which role remains unclear. ITM2B mutations have been associated with different disorders: mutations leading to longer mutant proteins have been reported in two distinct Alzheimer-like autosomal dominant



Global Trade Item Number

SKUGTIN
HPA001462-100UL04061837132797
HPA001462-25UL04061842772933