Skip to Content
Merck
CN

HPA001672

Anti-SLC9A3R2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-NHE3 kinase A regulatory protein E3KARP antibody produced in rabbit, Anti-NHERF-2 antibody produced in rabbit, Anti-Na+/H+ exchange regulatory cofactor NHE-RF2 antibody produced in rabbit, Anti-SIP-1 antibody produced in rabbit, Anti-SRY-interacting protein 1 antibody produced in rabbit, Anti-Solute carrier family 9 isoform A3 regulatory factor 2 antibody produced in rabbit, Anti-TKA-1 antibody produced in rabbit, Anti-Tyrosine kinase activator protein 1 antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
8
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC9A3R2(9351)

Immunogen

Na+/H+ exchange regulatory cofactor NHE-RF2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SLC9A3R2 (solute carrier family 9, subfamily A, NHE3, cation proton antiporter 3, member 3 regulator 2) is a major adaptor protein involved in the anchoring of ion channels and receptors to the actin cytoskeleton via ERM (ezrin/radixin/moesin) protein interaction. It works as a Na+/H+ exchanger in the brush border membrane of the proximal tubule and small intestine. It plays a major role in the trans-epithelial Na+ absorption, which is regulated by cAMP (cyclic adenosine monophosphate). The protein consists of two PSD-95/Dlg/ZO-1 (PDZ) domains, which bind the PDZ docking motif (X-(S/T)-X-(V/L)) of proteins to allow the assembly of transmembrane and cytoplasmic proteins into active signal transduction complexes. In SGK1 (serum and glucocorticoid induced protein kinase 1) activation mechanism, it helps to activate and phosphorylate SGK1 by 3-phosphoinositide-dependent protein kinase 1 (PDK1) through its PDZ domain and PIF (PDK1 interacting fragment) motif.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST85045

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
低风险生物材料

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library


Protocols

Subcellular protein location often correlates with function; nucleus proteins implicated in gene regulation, mitochondria proteins in energy production.

Related Content

Prestige Antibodies Immunofluorescence Procedure


Michihiro Yoshida et al.
American journal of physiology. Gastrointestinal and liver physiology, 310(8), G586-G598 (2016-02-13)
The Na(+)/H(+) exchanger regulatory factor (NHERF) family of proteins is scaffolds that orchestrate interaction of receptors and cellular proteins. Previous studies have shown that NHERF1 functions as a tumor suppressor. The goal of this study is to determine whether the
Shin-ichi Terawaki et al.
Structure (London, England : 1993), 14(4), 777-789 (2006-04-18)
The Na+/H+ exchanger regulatory factor (NHERF) is a key adaptor protein involved in the anchoring of ion channels and receptors to the actin cytoskeleton through binding to ERM (ezrin/radixin/moesin) proteins. NHERF binds the FERM domain of ERM proteins, although NHERF
C H Yun et al.
The Journal of biological chemistry, 273(40), 25856-25863 (1998-09-25)
Cyclic AMP is a major second messenger that inhibits the brush border Na+/H+ exchanger NHE3. We have previously shown that either of two related regulatory proteins, E3KARP or NHERF, is necessary for the cAMP-dependent inhibition of NHE3. In the present



Global Trade Item Number

SKUGTIN
HPA001672-100UL04061837133091
HPA001672-25UL04061842773725